PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 152aa    MW: 16786.1 Da    PI: 10.386
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025870.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-182862135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++
  Do025870.1 28 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 62
                ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.05E-132161No hitNo description
SMARTSM004013.3E-142275IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.5712258IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-142662IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.97E-142762No hitNo description
PfamPF003205.2E-162862IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402853IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MDSSVDKQQG SGSPDPDERP ASGEPKACTE CHTTKTPLWR GGPCGPMSLC NACGIRYRKK  60
RREALGLDAN KAAGGEQQQQ QRKKKTAAAA SSKREREKEA EADEVTVELR TVGFGKEVVL  120
KQRRRMRRRR RLGEEERAAI LLMALSSGVV YA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121127QRRRMRR
2123128RRMRRR
3123130RRMRRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00554DAPTransfer from AT5G49300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280131e-110KJ728013.1 Zea mays clone pUT6148 C2C2-GATA transcription factor (GATA18) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981176.11e-67PREDICTED: GATA transcription factor 16-like isoform X1
TrEMBLK4AG852e-67K4AG85_SETIT; Uncharacterized protein
STRINGSi037892m4e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24183892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.13e-18GATA transcription factor 23